Lineage for d1mxmf2 (1mxm F:180-280)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 605136Superfamily d.58.43: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82689] (1 family) (S)
    the last strand of the fold is flipped away and involved in oligomerisation
  5. 605137Family d.58.43.1: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82690] (1 protein)
  6. 605138Protein Mechanosensitive channel protein MscS (YggB), C-terminal domain [82691] (1 species)
  7. 605139Species Escherichia coli [TaxId:562] [82692] (1 PDB entry)
  8. 605145Domain d1mxmf2: 1mxm F:180-280 [79663]
    Other proteins in same PDB: d1mxma1, d1mxma3, d1mxmb1, d1mxmb3, d1mxmc1, d1mxmc3, d1mxmd1, d1mxmd3, d1mxme1, d1mxme3, d1mxmf1, d1mxmf3, d1mxmg1, d1mxmg3

Details for d1mxmf2

PDB Entry: 1mxm (more details), 3.9 Å

PDB Description: Crystal Structure of MscS at 3.9 Resolution

SCOP Domain Sequences for d1mxmf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxmf2 d.58.43.1 (F:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli}
repvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrv
wsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv

SCOP Domain Coordinates for d1mxmf2:

Click to download the PDB-style file with coordinates for d1mxmf2.
(The format of our PDB-style files is described here.)

Timeline for d1mxmf2: