SCOP 1.71: Domain d1mxme1: 1mxm E:113-179

Lineage for d1mxme1 (1mxm E:113-179)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.38: Sm-like fold [50181] (2 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families)

5. Family b.38.1.3: Mechanosensitive channel protein MscS (YggB), middle domain [82090] (1 protein)

6. Protein Mechanosensitive channel protein MscS (YggB), middle domain [82091] (1 species)
   forms homoheptameric ring structure very similar to those of the archaeal and eukaryotic Sm proteins

7. Species Escherichia coli [TaxId:562] [82092] (1 PDB entry)

8. Domain d1mxme1: 1mxm E:113-179 [79659]
   Other proteins in same PDB: d1mxma2, d1mxma3, d1mxmb2, d1mxmb3, d1mxmc2, d1mxmc3, d1mxmd2, d1mxmd3, d1mxme2, d1mxme3, d1mxmf2, d1mxmf3, d1mxmg2, d1mxmg3

Details for d1mxme1

PDB Entry: 1mxm, 3.9 Å

PDB Description: Crystal Structure of MscS at 3.9 Resolution

SCOP Domain Sequences for d1mxme1:

Sequence; same for both SEQRES and ATOM records:

>d1mxme1 b.38.1.3 (E:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli}
gslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiia
gniinfs

Timeline for d1mxme1:

• d1mxme1 first appeared in SCOP 1.63
  
• d1mxme1 appears in SCOP 1.69
  
• d1mxme1 does not appear in SCOP 1.73