Lineage for d1mxme1 (1mxm E:113-179)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462478Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 462479Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 462738Family b.38.1.3: Mechanosensitive channel protein MscS (YggB), middle domain [82090] (1 protein)
  6. 462739Protein Mechanosensitive channel protein MscS (YggB), middle domain [82091] (1 species)
    forms homoheptameric ring structure very similar to those of the archaeal and eukaryotic Sm proteins
  7. 462740Species Escherichia coli [TaxId:562] [82092] (1 PDB entry)
  8. 462745Domain d1mxme1: 1mxm E:113-179 [79659]
    Other proteins in same PDB: d1mxma2, d1mxma3, d1mxmb2, d1mxmb3, d1mxmc2, d1mxmc3, d1mxmd2, d1mxmd3, d1mxme2, d1mxme3, d1mxmf2, d1mxmf3, d1mxmg2, d1mxmg3

Details for d1mxme1

PDB Entry: 1mxm (more details), 3.9 Å

PDB Description: Crystal Structure of MscS at 3.9 Resolution

SCOP Domain Sequences for d1mxme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxme1 b.38.1.3 (E:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli}
gslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiia
gniinfs

SCOP Domain Coordinates for d1mxme1:

Click to download the PDB-style file with coordinates for d1mxme1.
(The format of our PDB-style files is described here.)

Timeline for d1mxme1: