Lineage for d1mxmc3 (1mxm C:27-112)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620990Fold f.34: Mechanosensitive channel protein MscS (YggB), transmembrane region [82860] (1 superfamily)
    oligomeric fold; 3 transmembrane helices per subunit
  4. 620991Superfamily f.34.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82861] (1 family) (S)
  5. 620992Family f.34.1.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82862] (1 protein)
  6. 620993Protein Mechanosensitive channel protein MscS (YggB), transmembrane region [82863] (1 species)
    homoheptameric protein
  7. 620994Species Escherichia coli [TaxId:562] [82864] (1 PDB entry)
  8. 620997Domain d1mxmc3: 1mxm C:27-112 [79655]
    Other proteins in same PDB: d1mxma1, d1mxma2, d1mxmb1, d1mxmb2, d1mxmc1, d1mxmc2, d1mxmd1, d1mxmd2, d1mxme1, d1mxme2, d1mxmf1, d1mxmf2, d1mxmg1, d1mxmg2

Details for d1mxmc3

PDB Entry: 1mxm (more details), 3.9 Å

PDB Description: Crystal Structure of MscS at 3.9 Resolution

SCOP Domain Sequences for d1mxmc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxmc3 f.34.1.1 (C:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli}
yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
grvgvqtasviavlgaaglavglalq

SCOP Domain Coordinates for d1mxmc3:

Click to download the PDB-style file with coordinates for d1mxmc3.
(The format of our PDB-style files is described here.)

Timeline for d1mxmc3: