Lineage for d1mxmc2 (1mxm C:180-280)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 330061Superfamily d.58.43: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82689] (1 family) (S)
    the last strand of the fold is flipped away and involved in oligomerisation
  5. 330062Family d.58.43.1: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82690] (1 protein)
  6. 330063Protein Mechanosensitive channel protein MscS (YggB), C-terminal domain [82691] (1 species)
  7. 330064Species Escherichia coli [TaxId:562] [82692] (1 PDB entry)
  8. 330067Domain d1mxmc2: 1mxm C:180-280 [79654]
    Other proteins in same PDB: d1mxma1, d1mxma3, d1mxmb1, d1mxmb3, d1mxmc1, d1mxmc3, d1mxmd1, d1mxmd3, d1mxme1, d1mxme3, d1mxmf1, d1mxmf3, d1mxmg1, d1mxmg3

Details for d1mxmc2

PDB Entry: 1mxm (more details), 3.9 Å

PDB Description: Crystal Structure of MscS at 3.9 Resolution

SCOP Domain Sequences for d1mxmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxmc2 d.58.43.1 (C:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli}
repvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrv
wsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv

SCOP Domain Coordinates for d1mxmc2:

Click to download the PDB-style file with coordinates for d1mxmc2.
(The format of our PDB-style files is described here.)

Timeline for d1mxmc2: