SCOP 1.69: Domain d1mxmb2: 1mxm B:180-280

Lineage for d1mxmb2 (1mxm B:180-280)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.43: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82689] (1 family)
   the last strand of the fold is flipped away and involved in oligomerisation

5. Family d.58.43.1: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82690] (1 protein)

6. Protein Mechanosensitive channel protein MscS (YggB), C-terminal domain [82691] (1 species)

7. Species Escherichia coli [TaxId:562] [82692] (1 PDB entry)

8. Domain d1mxmb2: 1mxm B:180-280 [79651]
   Other proteins in same PDB: d1mxma1, d1mxma3, d1mxmb1, d1mxmb3, d1mxmc1, d1mxmc3, d1mxmd1, d1mxmd3, d1mxme1, d1mxme3, d1mxmf1, d1mxmf3, d1mxmg1, d1mxmg3

Details for d1mxmb2

PDB Entry: 1mxm, 3.9 Å

PDB Description: Crystal Structure of MscS at 3.9 Resolution

SCOP Domain Sequences for d1mxmb2:

Sequence; same for both SEQRES and ATOM records:

>d1mxmb2 d.58.43.1 (B:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli}
repvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrv
wsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv

Timeline for d1mxmb2:

• d1mxmb2 first appeared in SCOP 1.63
  
• d1mxmb2 appears in SCOP 1.67
  
• d1mxmb2 last appears in SCOP 1.71