Lineage for d1mxmb1 (1mxm B:113-179)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373598Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 373599Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 373858Family b.38.1.3: Mechanosensitive channel protein MscS (YggB), middle domain [82090] (1 protein)
  6. 373859Protein Mechanosensitive channel protein MscS (YggB), middle domain [82091] (1 species)
    forms homoheptameric ring structure very similar to those of the archaeal and eukaryotic Sm proteins
  7. 373860Species Escherichia coli [TaxId:562] [82092] (1 PDB entry)
  8. 373862Domain d1mxmb1: 1mxm B:113-179 [79650]
    Other proteins in same PDB: d1mxma2, d1mxma3, d1mxmb2, d1mxmb3, d1mxmc2, d1mxmc3, d1mxmd2, d1mxmd3, d1mxme2, d1mxme3, d1mxmf2, d1mxmf3, d1mxmg2, d1mxmg3

Details for d1mxmb1

PDB Entry: 1mxm (more details), 3.9 Å

PDB Description: Crystal Structure of MscS at 3.9 Resolution

SCOP Domain Sequences for d1mxmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxmb1 b.38.1.3 (B:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli}
gslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiia
gniinfs

SCOP Domain Coordinates for d1mxmb1:

Click to download the PDB-style file with coordinates for d1mxmb1.
(The format of our PDB-style files is described here.)

Timeline for d1mxmb1: