SCOPe 2.07: Domain d1mxia_: 1mxi A:

Lineage for d1mxia_ (1mxi A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins)
   contains extra strand (3) in the parallel beta-sheet, order 321546

6. Protein Hypothetical tRNA/rRNA methyltransfease HI0766 (YibK homologue) [82374] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [82375] (2 PDB entries)

8. Domain d1mxia_: 1mxi A: [79646]
   complexed with iod, sah

Details for d1mxia_

PDB Entry: 1mxi, 1.7 Å

PDB Description: Structure of YibK from Haemophilus influenzae (HI0766): a Methyltransferase with a Cofactor Bound at a Site Formed by a Knot

PDB Compounds: (A:) Hypothetical tRNA/rRNA methyltransferase HI0766

SCOPe Domain Sequences for d1mxia_:

Sequence; same for both SEQRES and ATOM records:

>d1mxia_ c.116.1.1 (A:) Hypothetical tRNA/rRNA methyltransfease HI0766 (YibK homologue) {Haemophilus influenzae [TaxId: 727]}
mldivlyepeipqntgniirlcantgfrlhlieplgftwddkrlrrsgldyhefaeikrh
ktfeaflesekpkrlfalttkgcpahsqvkfklgdylmfgpetrgipmsilnempmeqki
ripmtansrsmnlsnsvavtvyeawrqlgykgavnl

Timeline for d1mxia_:

• d1mxia_ first appeared in SCOP 1.63
  
• d1mxia_ appears in SCOPe 2.06
  
• d1mxia_ appears in the current release, SCOPe 2.08