Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (12 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47522] (13 PDB entries) |
Domain d1mxeb_: 1mxe B: [79645] complex with the target sequence of Calmodulin-dependent protein kinase I (1a06), chains E and F complexed with ca |
PDB Entry: 1mxe (more details), 1.7 Å
SCOPe Domain Sequences for d1mxeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mxeb_ a.39.1.5 (B:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti dfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevde mireadidgdgqvnyeefvtmmts
Timeline for d1mxeb_: