SCOPe 2.06: Domain d1mxeb_: 1mxe B:

Lineage for d1mxeb_ (1mxe B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (12 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47522] (13 PDB entries)

8. Domain d1mxeb_: 1mxe B: [79645]
   complex with the target sequence of Calmodulin-dependent protein kinase I (1a06), chains E and F
   complexed with ca

Details for d1mxeb_

PDB Entry: 1mxe, 1.7 Å

PDB Description: Structure of the Complex of Calmodulin with the Target Sequence of CaMKI

PDB Compounds: (B:) calmodulin

SCOPe Domain Sequences for d1mxeb_:

Sequence; same for both SEQRES and ATOM records:

>d1mxeb_ a.39.1.5 (B:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevde
mireadidgdgqvnyeefvtmmts

Timeline for d1mxeb_:

• d1mxeb_ first appeared in SCOP 1.63
  
• d1mxeb_ appears in SCOPe 2.05
  
• d1mxeb_ appears in SCOPe 2.07
  
• d1mxeb_ appears in the current release, SCOPe 2.08