![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
![]() | Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
![]() | Protein Transcription corepressor CtbP [82347] (2 species) C-terminal binding protein 1; a dehydrogenase |
![]() | Species Human (Homo sapiens), Ctbp1 [TaxId:9606] [82348] (1 PDB entry) |
![]() | Domain d1mx3a2: 1mx3 A:27-125,A:319-352 [79639] Other proteins in same PDB: d1mx3a1 complexed with acy, nad |
PDB Entry: 1mx3 (more details), 1.95 Å
SCOP Domain Sequences for d1mx3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1} mplvalldgrdctvempilkdvatvafcdaqstqeihekvlneavgalmyhtitltredl ekfkalriivrigsgfdnidiksagdlgiavcnvpaasvXyseqasiemreeaareirra itgripdslkncvn
Timeline for d1mx3a2: