SCOP 1.63: Domain d1mx3a2: 1mx3 A:27-125,A:319-352

Lineage for d1mx3a2 (1mx3 A:27-125,A:319-352)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
   this domain is interrupted by the Rossmann-fold domain

6. Protein Transcription corepressor CtbP [82347] (1 species)
   C-terminal binding protein 1; a dehydrogenase

7. Species Human (Homo sapiens) [TaxId:9606] [82348] (1 PDB entry)

8. Domain d1mx3a2: 1mx3 A:27-125,A:319-352 [79639]
   Other proteins in same PDB: d1mx3a1
   complexed with acy, nad

Details for d1mx3a2

PDB Entry: 1mx3, 1.95 Å

PDB Description: Crystal structure of CtBP dehydrogenase core holo form

SCOP Domain Sequences for d1mx3a2:

Sequence; same for both SEQRES and ATOM records:

>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens)}
mplvalldgrdctvempilkdvatvafcdaqstqeihekvlneavgalmyhtitltredl
ekfkalriivrigsgfdnidiksagdlgiavcnvpaasvXyseqasiemreeaareirra
itgripdslkncvn

Timeline for d1mx3a2:

• d1mx3a2 is new in SCOP 1.63
  
• d1mx3a2 appears in SCOP 1.65
  
• d1mx3a2 appears in the current release, SCOPe 2.08