Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein Transcription corepressor CtbP [82298] (2 species) C-terminal binding protein 1; a dehydrogenase |
Species Human (Homo sapiens), Ctbp1 [TaxId:9606] [82299] (1 PDB entry) |
Domain d1mx3a1: 1mx3 A:126-318 [79638] Other proteins in same PDB: d1mx3a2 complexed with acy, nad |
PDB Entry: 1mx3 (more details), 1.95 Å
SCOP Domain Sequences for d1mx3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1} eetadstlchilnlyrratwlhqalregtrvqsveqirevasgaarirgetlgiiglgrv gqavalrakafgfnvlfydpylsdgveralglqrvstlqdllfhsdcvtlhcglnehnhh lindftvkqmrqgaflvntargglvdekalaqalkegrirgaaldvhesepfsfsqgplk dapnlictphaaw
Timeline for d1mx3a1: