Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (6 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein) some sequence similarity to KSI |
Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [82597] (5 PDB entries) |
Domain d1mwxb1: 1mwx B:27-138 [79613] Other proteins in same PDB: d1mwxa2, d1mwxa3, d1mwxb2, d1mwxb3 complexed with cd, cl; mutant |
PDB Entry: 1mwx (more details), 1.8 Å
SCOP Domain Sequences for d1mwxb1:
Sequence, based on SEQRES records: (download)
>d1mwxb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus} dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
>d1mwxb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus} dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik krvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d1mwxb1: