SCOP 1.63: Domain d1mwxb1: 1mwx B:27-138

Lineage for d1mwxb1 (1mwx B:27-138)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (6 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
   some sequence similarity to KSI

6. Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [82597] (5 PDB entries)

8. Domain d1mwxb1: 1mwx B:27-138 [79613]
   Other proteins in same PDB: d1mwxa2, d1mwxa3, d1mwxb2, d1mwxb3
   complexed with cd, cl; mutant

Details for d1mwxb1

PDB Entry: 1mwx, 1.8 Å

PDB Description: Structure of Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 1.80 A resolution.

SCOP Domain Sequences for d1mwxb1:

Sequence, based on SEQRES records:

>d1mwxb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Sequence, based on observed residues (ATOM records):

>d1mwxb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
krvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Timeline for d1mwxb1:

• d1mwxb1 is new in SCOP 1.63
  
• d1mwxb1 appears in SCOP 1.65
  
• d1mwxb1 last appears in SCOP 1.69