Lineage for d1mwta3 (1mwt A:328-668)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450582Protein Penicillin binding protein 2a (PBP2A), C-terminal domain [82838] (1 species)
  7. 1450583Species Staphylococcus aureus [TaxId:1280] [82839] (6 PDB entries)
    Uniprot O54286 27-668
  8. 1450588Domain d1mwta3: 1mwt A:328-668 [79600]
    Other proteins in same PDB: d1mwta1, d1mwta2, d1mwtb1, d1mwtb2
    complexed with cd, cl

Details for d1mwta3

PDB Entry: 1mwt (more details), 2.45 Å

PDB Description: structure of penicillin g acyl-penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 2.45 a resolution.
PDB Compounds: (A:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwta3:

Sequence, based on SEQRES records: (download)

>d1mwta3 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm
mmainvkdvqdkgmasynakisgkvydelyengnkkydide

Sequence, based on observed residues (ATOM records): (download)

>d1mwta3 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelgrqigwfisydkdnpnmmmainvk
dvqdkgmasynakisgkvydelyengnkkydide

SCOPe Domain Coordinates for d1mwta3:

Click to download the PDB-style file with coordinates for d1mwta3.
(The format of our PDB-style files is described here.)

Timeline for d1mwta3: