SCOPe 2.06: Domain d1mwsb1: 1mws B:27-138

Lineage for d1mwsb1 (1mws B:27-138)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
   some sequence similarity to KSI
   automatically mapped to Pfam PF05223

6. Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [82597] (10 PDB entries)
   Uniprot O54286 27-668

8. Domain d1mwsb1: 1mws B:27-138 [79595]
   Other proteins in same PDB: d1mwsa2, d1mwsa3, d1mwsb2, d1mwsb3
   complexed with cd, cl

Details for d1mwsb1

PDB Entry: 1mws, 2 Å

PDB Description: Structure of nitrocefin acyl-Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 2.00 A resolution.

PDB Compounds: (B:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwsb1:

Sequence, based on SEQRES records:

>d1mwsb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Sequence, based on observed residues (ATOM records):

>d1mwsb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Timeline for d1mwsb1:

• d1mwsb1 first appeared in SCOP 1.63
  
• d1mwsb1 appears in SCOPe 2.05
  
• d1mwsb1 appears in SCOPe 2.07
  
• d1mwsb1 appears in the current release, SCOPe 2.08