SCOPe 2.02: Domain d1mwra2: 1mwr A:139-327

Lineage for d1mwra2 (1mwr A:139-327)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family)

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
   contains an insert subdomain of ClpS-like fold

6. Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
   the insert subdomain (residues 168-239) is fully ordered

7. Species Staphylococcus aureus [TaxId:1280] [82825] (5 PDB entries)
   Uniprot O54286 27-668

8. Domain d1mwra2: 1mwr A:139-327 [79587]
   Other proteins in same PDB: d1mwra1, d1mwra3, d1mwrb1, d1mwrb3
   complexed with cd, cl

Details for d1mwra2

PDB Entry: 1mwr, 2.45 Å

PDB Description: Structure of SeMet Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r (trigonal form) at 2.45 A resolution.

PDB Compounds: (A:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwra2:

Sequence, based on SEQRES records:

>d1mwra2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Sequence, based on observed residues (ATOM records):

>d1mwra2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddsntiahtliekkkk
dgkdiqlt

Timeline for d1mwra2:

• d1mwra2 first appeared in SCOP 1.63
  
• d1mwra2 appears in SCOPe 2.01
  
• d1mwra2 appears in SCOPe 2.03
  
• d1mwra2 appears in the current release, SCOPe 2.08