Lineage for d1mwra1 (1mwr A:27-138)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1197160Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1197512Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
    some sequence similarity to KSI
  6. 1197513Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)
  7. 1197514Species Staphylococcus aureus [TaxId:1280] [82597] (5 PDB entries)
    Uniprot O54286 27-668
  8. 1197523Domain d1mwra1: 1mwr A:27-138 [79586]
    Other proteins in same PDB: d1mwra2, d1mwra3, d1mwrb2, d1mwrb3
    complexed with cd, cl

Details for d1mwra1

PDB Entry: 1mwr (more details), 2.45 Å

PDB Description: Structure of SeMet Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r (trigonal form) at 2.45 A resolution.
PDB Compounds: (A:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwra1:

Sequence, based on SEQRES records: (download)

>d1mwra1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Sequence, based on observed residues (ATOM records): (download)

>d1mwra1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
krvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d1mwra1:

Click to download the PDB-style file with coordinates for d1mwra1.
(The format of our PDB-style files is described here.)

Timeline for d1mwra1: