Lineage for d1mwma1 (1mwm A:1-157)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586265Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) (S)
    duplication contains two domains of this fold
  5. 586266Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 586425Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 586426Species Escherichia coli [TaxId:562] [82439] (2 PDB entries)
  8. 586427Domain d1mwma1: 1mwm A:1-157 [79580]

Details for d1mwma1

PDB Entry: 1mwm (more details), 2 Å

PDB Description: parm from plasmid r1 adp form

SCOP Domain Sequences for d1mwma1:

Sequence, based on SEQRES records: (download)

>d1mwma1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl

Sequence, based on observed residues (ATOM records): (download)

>d1mwma1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdtniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenierkka
nfrkkitlnggdtftikdvkvmpesipagyevl

SCOP Domain Coordinates for d1mwma1:

Click to download the PDB-style file with coordinates for d1mwma1.
(The format of our PDB-style files is described here.)

Timeline for d1mwma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwma2