| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
| Protein Plasmid segregation protein ParM [82438] (1 species) |
| Species Escherichia coli [TaxId:562] [82439] (2 PDB entries) |
| Domain d1mwka1: 1mwk A:1-157 [79576] |
PDB Entry: 1mwk (more details), 2.3 Å
SCOP Domain Sequences for d1mwka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwka1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl
Timeline for d1mwka1: