SCOP 1.75: Domain d1mwam_: 1mwa M:

Lineage for d1mwam_ (1mwa M:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
   Uniprot P01887

8. Domain d1mwam_: 1mwa M: [79571]
   Other proteins in same PDB: d1mwaa1, d1mwaa2, d1mwab1, d1mwab2, d1mwac1, d1mwac2, d1mwad1, d1mwad2, d1mwah1, d1mwah2, d1mwai1, d1mwai2
   complexed with acy, gol, man, nag

Details for d1mwam_

PDB Entry: 1mwa, 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

PDB Compounds: (M:) microglobulin MHC light chain

SCOP Domain Sequences for d1mwam_:

Sequence; same for both SEQRES and ATOM records:

>d1mwam_ b.1.1.2 (M:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1mwam_:

• d1mwam_ first appeared in SCOP 1.63
  
• d1mwam_ appears in SCOP 1.73
  
• d1mwam_ appears in SCOPe 2.01
  
• d1mwam_ appears in the current release, SCOPe 2.08