Lineage for d1mwah1 (1mwa H:182-274)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291448Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1291720Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries)
    Uniprot P01901 22-299
  8. 1291870Domain d1mwah1: 1mwa H:182-274 [79566]
    Other proteins in same PDB: d1mwaa1, d1mwaa2, d1mwab1, d1mwab2, d1mwac1, d1mwac2, d1mwad1, d1mwad2, d1mwah2, d1mwai2, d1mwal_, d1mwam_
    complexed with acy, gol, nag

Details for d1mwah1

PDB Entry: 1mwa (more details), 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex
PDB Compounds: (H:) h-2kbm3 MHC class I molecule heavy chain

SCOPe Domain Sequences for d1mwah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwah1 b.1.1.2 (H:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOPe Domain Coordinates for d1mwah1:

Click to download the PDB-style file with coordinates for d1mwah1.
(The format of our PDB-style files is described here.)

Timeline for d1mwah1: