![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries) |
![]() | Domain d1mwah1: 1mwa H:182-274 [79566] Other proteins in same PDB: d1mwaa1, d1mwaa2, d1mwab1, d1mwab2, d1mwac1, d1mwac2, d1mwad1, d1mwad2, d1mwah2, d1mwai2, d1mwal_, d1mwam_ |
PDB Entry: 1mwa (more details), 2.4 Å
SCOP Domain Sequences for d1mwah1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwah1 b.1.1.2 (H:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d1mwah1: