Lineage for d1mwad2 (1mwa D:118-247)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517073Protein T-cell antigen receptor [49125] (7 species)
  7. 1517185Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 1517205Domain d1mwad2: 1mwa D:118-247 [79565]
    Other proteins in same PDB: d1mwaa1, d1mwab1, d1mwac1, d1mwad1, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_
    complexed with acy, gol, nag

Details for d1mwad2

PDB Entry: 1mwa (more details), 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex
PDB Compounds: (D:) 2c t cell receptor beta chain

SCOPe Domain Sequences for d1mwad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwad2 b.1.1.2 (D:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

SCOPe Domain Coordinates for d1mwad2:

Click to download the PDB-style file with coordinates for d1mwad2.
(The format of our PDB-style files is described here.)

Timeline for d1mwad2: