Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) |
Domain d1mwad1: 1mwa D:1-117 [79564] Other proteins in same PDB: d1mwaa2, d1mwab2, d1mwac2, d1mwad2, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_ complexed with acy, gol, nag |
PDB Entry: 1mwa (more details), 2.4 Å
SCOPe Domain Sequences for d1mwad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwad1 b.1.1.1 (D:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle
Timeline for d1mwad1: