SCOPe 2.03: Domain d1mwab2: 1mwa B:118-247

Lineage for d1mwab2 (1mwa B:118-247)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)

8. Domain d1mwab2: 1mwa B:118-247 [79561]
   Other proteins in same PDB: d1mwaa1, d1mwab1, d1mwac1, d1mwad1, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_
   complexed with acy, gol, nag

Details for d1mwab2

PDB Entry: 1mwa, 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

PDB Compounds: (B:) 2c t cell receptor beta chain

SCOPe Domain Sequences for d1mwab2:

Sequence; same for both SEQRES and ATOM records:

>d1mwab2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

Timeline for d1mwab2:

• d1mwab2 first appeared in SCOP 1.63
  
• d1mwab2 appears in SCOPe 2.02
  
• d1mwab2 appears in SCOPe 2.04
  
• d1mwab2 appears in the current release, SCOPe 2.08