SCOPe 2.04: Domain d1mwaa1: 1mwa A:1-117

Lineage for d1mwaa1 (1mwa A:1-117)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)

8. Domain d1mwaa1: 1mwa A:1-117 [79558]
   Other proteins in same PDB: d1mwaa2, d1mwab2, d1mwac2, d1mwad2, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_
   complexed with acy, gol, nag

Details for d1mwaa1

PDB Entry: 1mwa, 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

PDB Compounds: (A:) 2c t cell receptor alpha chain

SCOPe Domain Sequences for d1mwaa1:

Sequence; same for both SEQRES and ATOM records:

>d1mwaa1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

Timeline for d1mwaa1:

• d1mwaa1 first appeared in SCOP 1.63
  
• d1mwaa1 appears in SCOPe 2.03
  
• d1mwaa1 appears in SCOPe 2.05
  
• d1mwaa1 appears in the current release, SCOPe 2.08