Lineage for d1mw2a1 (1mw2 A:555-628)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804047Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1804064Protein Amylosucrase [69328] (1 species)
  7. 1804065Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries)
  8. 1804075Domain d1mw2a1: 1mw2 A:555-628 [79553]
    Other proteins in same PDB: d1mw2a2
    complexed with suc, trs

Details for d1mw2a1

PDB Entry: 1mw2 (more details), 2.1 Å

PDB Description: amylosucrase soaked with 100mm sucrose
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d1mw2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mw2a1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

SCOPe Domain Coordinates for d1mw2a1:

Click to download the PDB-style file with coordinates for d1mw2a1.
(The format of our PDB-style files is described here.)

Timeline for d1mw2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mw2a2