Lineage for d1mvya1 (1mvy A:555-628)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1327912Protein Amylosucrase [69328] (1 species)
  7. 1327913Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries)
  8. 1327916Domain d1mvya1: 1mvy A:555-628 [79547]
    Other proteins in same PDB: d1mvya2
    complexed with trs; mutant

Details for d1mvya1

PDB Entry: 1mvy (more details), 2 Å

PDB Description: amylosucrase mutant e328q co-crystallized with maltoheptaose.
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d1mvya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvya1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

SCOPe Domain Coordinates for d1mvya1:

Click to download the PDB-style file with coordinates for d1mvya1.
(The format of our PDB-style files is described here.)

Timeline for d1mvya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mvya2