Lineage for d1mvkf_ (1mvk F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 718046Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 718047Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 718072Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 718073Species Streptococcus sp., group G [TaxId:1306] [54361] (28 PDB entries)
  8. 718091Domain d1mvkf_: 1mvk F: [79506]

Details for d1mvkf_

PDB Entry: 1mvk (more details), 2.5 Å

PDB Description: x-ray structure of the tetrameric mutant of the b1 domain of streptococcal protein g
PDB Compounds: (F:) immunoglobulin g binding protein g

SCOP Domain Sequences for d1mvkf_:

Sequence, based on SEQRES records: (download)

>d1mvkf_ d.15.7.1 (F:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

Sequence, based on observed residues (ATOM records): (download)

>d1mvkf_ d.15.7.1 (F:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilneavdaatfekvvkqffndngvdgewtyddatktftvte

SCOP Domain Coordinates for d1mvkf_:

Click to download the PDB-style file with coordinates for d1mvkf_.
(The format of our PDB-style files is described here.)

Timeline for d1mvkf_: