Lineage for d1mujb2 (1muj B:3-93)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326974Protein Class II MHC beta chain, N-terminal domain [88819] (13 species)
  7. 327020Species Mouse (Mus musculus), I-AB [TaxId:10090] [88828] (2 PDB entries)
  8. 327021Domain d1mujb2: 1muj B:3-93 [79491]
    Other proteins in same PDB: d1muja1, d1muja2, d1mujb1
    complex with a human clip peptide, chain C
    complexed with nag

Details for d1mujb2

PDB Entry: 1muj (more details), 2.15 Å

PDB Description: Crystal structure of murine class II MHC I-Ab in complex with a human CLIP peptide

SCOP Domain Sequences for d1mujb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mujb2 d.19.1.1 (B:3-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB}
serhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehravtelgrpdaeywn
sqpeilertraeldtvcrhnyegpethtslrr

SCOP Domain Coordinates for d1mujb2:

Click to download the PDB-style file with coordinates for d1mujb2.
(The format of our PDB-style files is described here.)

Timeline for d1mujb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mujb1