Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d1mujb1: 1muj B:94-192 [79490] Other proteins in same PDB: d1muja1, d1muja2, d1mujb2 complexed with nag |
PDB Entry: 1muj (more details), 2.15 Å
SCOPe Domain Sequences for d1mujb1:
Sequence, based on SEQRES records: (download)
>d1mujb1 b.1.1.2 (B:94-192) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw tfqvlvmlemtprrgevytchvehpslkspitvewssae
>d1mujb1 b.1.1.2 (B:94-192) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} leqpnvvislshntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm lemtprrgevytchvehpslkspitvewssae
Timeline for d1mujb1: