Lineage for d1muja1 (1muj A:84-183)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107077Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1107127Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1107132Domain d1muja1: 1muj A:84-183 [79488]
    Other proteins in same PDB: d1muja2, d1mujb1, d1mujb2
    complexed with nag

Details for d1muja1

PDB Entry: 1muj (more details), 2.15 Å

PDB Description: Crystal structure of murine class II MHC I-Ab in complex with a human CLIP peptide
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d1muja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
neapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrdy
sfhklsyltfipsdddiydckvehwgleepvlkhwssadl

SCOPe Domain Coordinates for d1muja1:

Click to download the PDB-style file with coordinates for d1muja1.
(The format of our PDB-style files is described here.)

Timeline for d1muja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1muja2