Lineage for d1muja1 (1muj A:84-183)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364807Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 364852Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 364854Domain d1muja1: 1muj A:84-183 [79488]
    Other proteins in same PDB: d1muja2, d1mujb1, d1mujb2
    complexed with nag

Details for d1muja1

PDB Entry: 1muj (more details), 2.15 Å

PDB Description: crystal structure of murine class ii mhc i-ab in complex with a human clip peptide

SCOP Domain Sequences for d1muja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
neapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrdy
sfhklsyltfipsdddiydckvehwgleepvlkhwssadl

SCOP Domain Coordinates for d1muja1:

Click to download the PDB-style file with coordinates for d1muja1.
(The format of our PDB-style files is described here.)

Timeline for d1muja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1muja2