SCOP 1.65: Domain d1muja1: 1muj A:84-183

Lineage for d1muja1 (1muj A:84-183)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1muja1: 1muj A:84-183 [79488]
   Other proteins in same PDB: d1muja2, d1mujb1, d1mujb2
   complexed with nag

Details for d1muja1

PDB Entry: 1muj, 2.15 Å

PDB Description: crystal structure of murine class ii mhc i-ab in complex with a human clip peptide

SCOP Domain Sequences for d1muja1:

Sequence; same for both SEQRES and ATOM records:

>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
neapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrdy
sfhklsyltfipsdddiydckvehwgleepvlkhwssadl

Timeline for d1muja1:

• d1muja1 first appeared in SCOP 1.63
  
• d1muja1 appears in SCOP 1.67
  
• d1muja1 appears in the current release, SCOPe 2.08