SCOPe 2.05: Domain d1mu5a2: 1mu5 A:307-470

Lineage for d1mu5a2 (1mu5 A:307-470)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)

6. Protein Topoisomerase VI-B subunit [82577] (1 species)
   contains an H2TH domain inserted in front of this domain and after the N-terminal ATPase domain

7. Species Sulfolobus shibatae [TaxId:2286] [82578] (7 PDB entries)

8. Domain d1mu5a2: 1mu5 A:307-470 [79473]
   Other proteins in same PDB: d1mu5a1, d1mu5a3
   complexed with ca

Details for d1mu5a2

PDB Entry: 1mu5, 2 Å

PDB Description: Structure of topoisomerase subunit

PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1mu5a2:

Sequence; same for both SEQRES and ATOM records:

>d1mu5a2 d.14.1.3 (A:307-470) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]}
rspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvge
epivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksag
kesiaevediekeiknalmevarklkqylsekrkeqeakkklla

Timeline for d1mu5a2:

• d1mu5a2 first appeared in SCOP 1.63
  
• d1mu5a2 appears in SCOPe 2.04
  
• d1mu5a2 appears in SCOPe 2.06
  
• d1mu5a2 appears in the current release, SCOPe 2.08