Lineage for d1mu5a2 (1mu5 A:307-470)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253872Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 253873Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 253927Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (4 proteins)
  6. 253949Protein Topoisomerase IV-B subunit [82577] (1 species)
    contains an H2TH domain inserted in front of this domain and after the N-terminal ATP-ase domain
  7. 253950Species Archaeon Sulfolobus shibatae [TaxId:2286] [82578] (2 PDB entries)
  8. 253951Domain d1mu5a2: 1mu5 A:307-470 [79473]
    Other proteins in same PDB: d1mu5a1, d1mu5a3
    complexed with ca

Details for d1mu5a2

PDB Entry: 1mu5 (more details), 2 Å

PDB Description: Structure of topoisomerase subunit
PDB Compounds: (A:)

SCOP Domain Sequences for d1mu5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mu5a2 d.14.1.3 (A:307-470) Topoisomerase IV-B subunit {Archaeon Sulfolobus shibatae}
rspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvge
epivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksag
kesiaevediekeiknalmevarklkqylsekrkeqeakkklla

SCOP Domain Coordinates for d1mu5a2:

Click to download the PDB-style file with coordinates for d1mu5a2.
(The format of our PDB-style files is described here.)

Timeline for d1mu5a2: