Lineage for d1mrub_ (1mru B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262793Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 262794Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 262795Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins)
  6. 262961Protein Mycobacterial protein kinase PknB, catalytic domain [82793] (1 species)
  7. 262962Species Mycobacterium tuberculosis [TaxId:1773] [82794] (2 PDB entries)
  8. 262965Domain d1mrub_: 1mru B: [79426]
    complexed with ags, mg

Details for d1mrub_

PDB Entry: 1mru (more details), 3 Å

PDB Description: intracellular ser/thr protein kinase domain of mycobacterium tuberculosis pknb.

SCOP Domain Sequences for d1mrub_:

Sequence, based on SEQRES records: (download)

>d1mrub_ d.144.1.1 (B:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis}
mttpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrrea
qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia
dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigta
qylspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarh
eglsadldavvlkalaknpenryqtaaemradlvrvhngeppeapk

Sequence, based on observed residues (ATOM records): (download)

>d1mrub_ d.144.1.1 (B:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis}
mttpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrrea
qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia
dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraitaqylspeqargdsvda
rsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkal
aknpenryqtaaemradlvrvhngeppeapk

SCOP Domain Coordinates for d1mrub_:

Click to download the PDB-style file with coordinates for d1mrub_.
(The format of our PDB-style files is described here.)

Timeline for d1mrub_: