Lineage for d1mrua_ (1mru A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544502Protein Mycobacterial protein kinase PknB, catalytic domain [82793] (1 species)
    OPK group; PKN subfamily; serine/threonine kinase
  7. 2544503Species Mycobacterium tuberculosis [TaxId:1773] [82794] (4 PDB entries)
  8. 2544509Domain d1mrua_: 1mru A: [79425]
    complexed with ags, mg

Details for d1mrua_

PDB Entry: 1mru (more details), 3 Å

PDB Description: intracellular ser/thr protein kinase domain of mycobacterium tuberculosis pknb.
PDB Compounds: (A:) Probable serine/threonine-protein kinase pknB

SCOPe Domain Sequences for d1mrua_:

Sequence, based on SEQRES records: (download)

>d1mrua_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaqy
lspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheg
lsadldavvlkalaknpenryqtaaemradlvrvhngeppeapk

Sequence, based on observed residues (ATOM records): (download)

>d1mrua_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraitaqylspeqargdsvdars
dvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalak
npenryqtaaemradlvrvhngeppeapk

SCOPe Domain Coordinates for d1mrua_:

Click to download the PDB-style file with coordinates for d1mrua_.
(The format of our PDB-style files is described here.)

Timeline for d1mrua_: