Lineage for d1mq8d_ (1mq8 D:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247390Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 247391Superfamily c.62.1: vWA-like [53300] (2 families) (S)
  5. 247392Family c.62.1.1: Integrin A (or I) domain [53301] (8 proteins)
  6. 247413Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 247414Species Human (Homo sapiens) [TaxId:9606] [53303] (10 PDB entries)
  8. 247429Domain d1mq8d_: 1mq8 D: [79410]
    Other proteins in same PDB: d1mq8a1, d1mq8a2, d1mq8c1, d1mq8c2
    complex with ICAM-1
    complexed with mg, nag; mutant

Details for d1mq8d_

PDB Entry: 1mq8 (more details), 3.3 Å

PDB Description: Crystal structure of alphaL I domain in complex with ICAM-1
PDB Compounds: (D:)

SCOP Domain Sequences for d1mq8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq8d_ c.62.1.1 (D:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens)}
vdlvflfdgsmslqpdefqkildfmkdvmkkcsntsyqfaavqfstsyktefdfsdyvkr
kdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgnid
aakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlctelqkki

SCOP Domain Coordinates for d1mq8d_:

Click to download the PDB-style file with coordinates for d1mq8d_.
(The format of our PDB-style files is described here.)

Timeline for d1mq8d_: