SCOP 1.67: Domain d1mq8c2: 1mq8 C:1-82

Lineage for d1mq8c2 (1mq8 C:1-82)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49163] (5 PDB entries)

8. Domain d1mq8c2: 1mq8 C:1-82 [79409]
   Other proteins in same PDB: d1mq8a1, d1mq8b_, d1mq8c1, d1mq8d_
   D1
   complexed with mg, nag; mutant

Details for d1mq8c2

PDB Entry: 1mq8, 3.3 Å

PDB Description: crystal structure of alphal i domain in complex with icam-1

SCOP Domain Sequences for d1mq8c2:

Sequence; same for both SEQRES and ATOM records:

>d1mq8c2 b.1.1.4 (C:1-82) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens)}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

Timeline for d1mq8c2:

• d1mq8c2 first appeared in SCOP 1.63
  
• d1mq8c2 appears in SCOP 1.65
  
• d1mq8c2 appears in SCOP 1.69
  
• d1mq8c2 appears in the current release, SCOPe 2.08