SCOPe 2.06: Domain d1mq8c1: 1mq8 C:83-184

Lineage for d1mq8c1 (1mq8 C:83-184)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)

8. Domain d1mq8c1: 1mq8 C:83-184 [79408]
   Other proteins in same PDB: d1mq8a2, d1mq8b_, d1mq8c2, d1mq8d_
   D2
   complexed with mg, nag

Details for d1mq8c1

PDB Entry: 1mq8, 3.3 Å

PDB Description: crystal structure of alphal i domain in complex with icam-1

PDB Compounds: (C:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1mq8c1:

Sequence; same for both SEQRES and ATOM records:

>d1mq8c1 b.1.1.3 (C:83-184) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqt

Timeline for d1mq8c1:

• d1mq8c1 first appeared in SCOP 1.63
  
• d1mq8c1 appears in SCOPe 2.05
  
• d1mq8c1 appears in SCOPe 2.07
  
• d1mq8c1 appears in the current release, SCOPe 2.08