Lineage for d1mq8a2 (1mq8 A:1-82)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031737Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)
  7. 2031738Species Human (Homo sapiens) [TaxId:9606] [49163] (6 PDB entries)
  8. 2031742Domain d1mq8a2: 1mq8 A:1-82 [79406]
    Other proteins in same PDB: d1mq8a1, d1mq8b_, d1mq8c1, d1mq8d_
    D1
    complexed with mg, nag

Details for d1mq8a2

PDB Entry: 1mq8 (more details), 3.3 Å

PDB Description: crystal structure of alphal i domain in complex with icam-1
PDB Compounds: (A:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1mq8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq8a2 b.1.1.4 (A:1-82) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

SCOPe Domain Coordinates for d1mq8a2:

Click to download the PDB-style file with coordinates for d1mq8a2.
(The format of our PDB-style files is described here.)

Timeline for d1mq8a2: