Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49163] (6 PDB entries) |
Domain d1mq8a2: 1mq8 A:1-82 [79406] Other proteins in same PDB: d1mq8a1, d1mq8b_, d1mq8c1, d1mq8d_ D1 complexed with mg, nag |
PDB Entry: 1mq8 (more details), 3.3 Å
SCOPe Domain Sequences for d1mq8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mq8a2 b.1.1.4 (A:1-82) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed sqpmcysncpdgqstaktfltv
Timeline for d1mq8a2:
View in 3D Domains from other chains: (mouse over for more information) d1mq8b_, d1mq8c1, d1mq8c2, d1mq8d_ |