Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49146] (6 PDB entries) |
Domain d1mq8a1: 1mq8 A:83-184 [79405] Other proteins in same PDB: d1mq8a2, d1mq8b_, d1mq8c2, d1mq8d_ |
PDB Entry: 1mq8 (more details), 3.3 Å
SCOP Domain Sequences for d1mq8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mq8a1 b.1.1.3 (A:83-184) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqt
Timeline for d1mq8a1:
View in 3D Domains from other chains: (mouse over for more information) d1mq8b_, d1mq8c1, d1mq8c2, d1mq8d_ |