Lineage for d1mq2a3 (1mq2 A:149-335)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265789Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 265790Superfamily d.218.1: Nucleotidyltransferase [81301] (4 families) (S)
  5. 265798Family d.218.1.2: DNA polymerase beta-like [81300] (3 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 265799Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 265800Species Human (Homo sapiens) [TaxId:9606] [81574] (92 PDB entries)
  8. 265875Domain d1mq2a3: 1mq2 A:149-335 [79396]
    Other proteins in same PDB: d1mq2a1, d1mq2a2
    complexed with 2da, 8og, a, na

Details for d1mq2a3

PDB Entry: 1mq2 (more details), 3.1 Å

PDB Description: Human DNA Polymerase Beta Complexed With Gapped DNA Containing an 8-oxo-7,8-dihydro-Guanine and dAMP

SCOP Domain Sequences for d1mq2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq2a3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens)}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOP Domain Coordinates for d1mq2a3:

Click to download the PDB-style file with coordinates for d1mq2a3.
(The format of our PDB-style files is described here.)

Timeline for d1mq2a3: