Lineage for d1mq2a2 (1mq2 A:92-148)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444633Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 444634Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 444635Protein DNA polymerase beta [81579] (2 species)
  7. 444636Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries)
  8. 444706Domain d1mq2a2: 1mq2 A:92-148 [79395]
    Other proteins in same PDB: d1mq2a1, d1mq2a3

Details for d1mq2a2

PDB Entry: 1mq2 (more details), 3.1 Å

PDB Description: Human DNA Polymerase Beta Complexed With Gapped DNA Containing an 8-oxo-7,8-dihydro-Guanine and dAMP

SCOP Domain Sequences for d1mq2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq2a2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOP Domain Coordinates for d1mq2a2:

Click to download the PDB-style file with coordinates for d1mq2a2.
(The format of our PDB-style files is described here.)

Timeline for d1mq2a2: