SCOP 1.73: Domain d1mpec_: 1mpe C:

Lineage for d1mpec_ (1mpe C:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (28 PDB entries)

8. Domain d1mpec_: 1mpe C: [79385]

Details for d1mpec_

PDB Entry: 1mpe

PDB Description: ensemble of 20 structures of the tetrameric mutant of the b1 domain of streptococcal protein g

PDB Compounds: (C:) immunoglobulin g binding protein g

SCOP Domain Sequences for d1mpec_:

Sequence; same for both SEQRES and ATOM records:

>d1mpec_ d.15.7.1 (C:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

Timeline for d1mpec_:

• d1mpec_ first appeared in SCOP 1.63
  
• d1mpec_ appears in SCOP 1.71
  
• d1mpec_ appears in SCOP 1.75
  
• d1mpec_ appears in the current release, SCOPe 2.08