SCOP 1.65: Domain d1mpeb_: 1mpe B:

Lineage for d1mpeb_ (1mpe B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (21 PDB entries)

8. Domain d1mpeb_: 1mpe B: [79384]

Details for d1mpeb_

PDB Entry: 1mpe

PDB Description: ensemble of 20 structures of the tetrameric mutant of the b1 domain of streptococcal protein g

SCOP Domain Sequences for d1mpeb_:

Sequence; same for both SEQRES and ATOM records:

>d1mpeb_ d.15.7.1 (B:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

Timeline for d1mpeb_:

• d1mpeb_ first appeared in SCOP 1.63
  
• d1mpeb_ appears in SCOP 1.67
  
• d1mpeb_ appears in the current release, SCOPe 2.08