Lineage for d1mp0b1 (1mp0 B:1-162,B:339-373)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461906Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 461907Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 461986Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (13 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 462004Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 462105Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (18 PDB entries)
  8. 462115Domain d1mp0b1: 1mp0 B:1-162,B:339-373 [79372]
    Other proteins in same PDB: d1mp0a2, d1mp0b2
    glutathione-dependent formaldehyde dehydrogenase

Details for d1mp0b1

PDB Entry: 1mp0 (more details), 2.2 Å

PDB Description: Binary Complex of Human Glutathione-Dependent Formaldehyde Dehydrogenase with NAD(H)

SCOP Domain Sequences for d1mp0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mp0b1 b.35.1.2 (B:1-162,B:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
lmpdgtsrftckgktilhymgtstfseytvvadisvakidplXikvdefvthnlsfdein
kafelmhsgksirtvvki

SCOP Domain Coordinates for d1mp0b1:

Click to download the PDB-style file with coordinates for d1mp0b1.
(The format of our PDB-style files is described here.)

Timeline for d1mp0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mp0b2