Lineage for d1mozb_ (1moz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866679Species Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId:4932] [82402] (1 PDB entry)
  8. 2866681Domain d1mozb_: 1moz B: [79369]
    complexed with gdp

Details for d1mozb_

PDB Entry: 1moz (more details), 3.17 Å

PDB Description: adp-ribosylation factor-like 1 (arl1) from saccharomyces cerevisiae
PDB Compounds: (B:) ADP-ribosylation factor-like protein 1

SCOPe Domain Sequences for d1mozb_:

Sequence, based on SEQRES records: (download)

>d1mozb_ c.37.1.8 (B:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}
gnifssmfdklwgsnkelrililgldgagkttilyrlqigevvttkptigfnvetlsykn
lklnvwdlggqtsirpywrcyyadtaavifvvdstdkdrmstaskelhlmlqeeelqdaa
llvfankqdqpgalsasevskelnlvelkdrswsivassaikgegitegldwlidvikee
ql

Sequence, based on observed residues (ATOM records): (download)

>d1mozb_ c.37.1.8 (B:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}
gnifssmfdklwgsnkelrililgldgagkttilyrlqigevvttkptigfnvetlsykn
lklnvwdlgirpywrcyyadtaavifvvdstdkdrmstaskelhlmlqeeelqdaallvf
ankqdqpgalsasevskelnlvelkdrswsivassaikgegitegldwlidvikeeql

SCOPe Domain Coordinates for d1mozb_:

Click to download the PDB-style file with coordinates for d1mozb_.
(The format of our PDB-style files is described here.)

Timeline for d1mozb_: