Lineage for d1mmza_ (1mmz A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782343Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1782611Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
    automatically mapped to Pfam PF01263
  6. 1782616Protein Galactose mutarotase [74912] (3 species)
  7. 1782626Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries)
  8. 1782637Domain d1mmza_: 1mmz A: [79309]
    complexed with arb, na

Details for d1mmza_

PDB Entry: 1mmz (more details), 1.8 Å

PDB Description: crystal structure of galactose mutarotase from lactococcus lactis complexed with l-arabinose
PDB Compounds: (A:) aldose 1-epimerase

SCOPe Domain Sequences for d1mmza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmza_ b.30.5.4 (A:) Galactose mutarotase {Lactococcus lactis [TaxId: 1358]}
sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
tfecqvspgseqipelgdislkagekyqattiyslhtkl

SCOPe Domain Coordinates for d1mmza_:

Click to download the PDB-style file with coordinates for d1mmza_.
(The format of our PDB-style files is described here.)

Timeline for d1mmza_: